Recombinant Human HPGD protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens 15-hydroxyprostaglandin dehydrogenase (HPGD), transcript variant 1 (NM_000860).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID P15428
Entry Name PGDH_HUMAN
Gene Names HPGD PGDH1 SDR36C1
Alternative Gene Names PGDH1 SDR36C1
Alternative Protein Names 15-hydroxyprostaglandin dehydrogenase [NAD(+)] (15-PGDH) (EC 1.1.1.141) (Prostaglandin dehydrogenase 1) (Short chain dehydrogenase/reductase family 36C member 1)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 266
Molecular Weight(Da) 28977
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MHVNGKVALVTGAAQGIGRAFAEALLLKGAKVALVDWNLEAGVQCKAALDEQFEPQKTLFIQCDVADQQQLRDTFRKVVDHFGRLDILVNNAGVNNEKNWEKTLQINLVSVISGTYLGLDYMSKQNGGEGGIIINMSSLAGLMPVAQQPVYCASKHGIVGFTRSAALAANLMNSGVRLNAICPGFVNTAILESIEKEENMGQYIEYKDHIKDMIKYYGILDPPLIANGLITLIEDDALNGAIMKITTSKGIHFQDYDTTPFQAKTQ
Background
Function FUNCTION: Primary enzyme catalyzing the conversion of hydroxylated arachidonic acid species to their corresponding oxidized metabolites (Probable). Prostaglandin inactivation, catalyzes the first step in the catabolic pathway of the prostaglandins. Contributes to the regulation of events that are under the control of prostaglandin levels (PubMed:15574495, PubMed:16828555, PubMed:8086429). Catalyzes the NAD-dependent dehydrogenation of lipoxin A4 to form 15-oxo-lipoxin A4 (PubMed:10837478). Converts 11(R)-HETE to 11-oxo-5,8,12,14-(Z,Z,E,Z)-eicosatetraenoic acid (ETE) (PubMed:21916491). Has hydroxylated docosahexaenoic acid metabolites as substrates (PubMed:25586183). Converts resolvins E1, D1 and D2 to their oxo products which represents a mode of resolvins inactivation and stabilizes their anti-inflammatory actions (PubMed:16757471, PubMed:22844113). {ECO:0000269|PubMed:10837478, ECO:0000269|PubMed:15574495, ECO:0000269|PubMed:16757471, ECO:0000269|PubMed:16828555, ECO:0000269|PubMed:21916491, ECO:0000269|PubMed:22844113, ECO:0000269|PubMed:25586183, ECO:0000269|PubMed:8086429, ECO:0000305|PubMed:25586183}.
Pathway
Protein Families Short-chain dehydrogenases/reductases (SDR) family
Tissue Specificity Detected in colon epithelium (at protein level). {ECO:0000269|PubMed:15574495}.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE8395986

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human HPGD protein
Copyright © 2021-present Echo Biosystems. All rights reserved.